(data stored in ACNUC7421 zone)

EMBL: CP000489.PE91

CP000489.PE91        Location/Qualifiers
FT   CDS             complement(83710..84885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68208"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY64"
FT                   /protein_id="ABL68208.1"
FT                   /translation="MQNSLLQLLTWTEATGRVLQHAHQVGRKHKLRAGFVSLFGYRLPD
FT                   CLPRFYCDKFGDPERFFAVQAANGYQNYFTNFSTNISERFVLRNMTRHPEARSASFPLP
FT                   QNFERYFKAHRAQAAEILAQQEAVTKVRRSTGDQKARAPEAEEAMARIAAWRARGGKVA
FT                   CAFGKVVCDSGVPFDGGPTHASMKDWINHCIRTVRGSDTLLLIKPHPHELNNQIATFPT
FT                   EFFSDLIEEEIGENVIFLGHRWFDMHDMAGLMDLGVIYNGTTSVELGIMGIPCILAGHF
FT                   APIDYPIGHIAPQTRAEFETYLRFEKPAIVAPDIRERAALWLHYMRSPDFTLPYRFHAR
FT                   PVTNKKIYPPYWFGEDLKALQTGENATPSRLARRVLGQEAEPGGQRMPSST"
     MQNSLLQLLT WTEATGRVLQ HAHQVGRKHK LRAGFVSLFG YRLPDCLPRF YCDKFGDPER        60
     FFAVQAANGY QNYFTNFSTN ISERFVLRNM TRHPEARSAS FPLPQNFERY FKAHRAQAAE       120
     ILAQQEAVTK VRRSTGDQKA RAPEAEEAMA RIAAWRARGG KVACAFGKVV CDSGVPFDGG       180
     PTHASMKDWI NHCIRTVRGS DTLLLIKPHP HELNNQIATF PTEFFSDLIE EEIGENVIFL       240
     GHRWFDMHDM AGLMDLGVIY NGTTSVELGI MGIPCILAGH FAPIDYPIGH IAPQTRAEFE       300
     TYLRFEKPAI VAPDIRERAA LWLHYMRSPD FTLPYRFHAR PVTNKKIYPP YWFGEDLKAL       360
     QTGENATPSR LARRVLGQEA EPGGQRMPSS T                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page