(data stored in ACNUC7421 zone)

EMBL: CP000489.PE92

CP000489.PE92        Location/Qualifiers
FT   CDS             complement(85055..86716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68209"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY65"
FT                   /protein_id="ABL68209.1"
FT                   /translation="MSTMTASLGRSWTERKWARRLFRGTPFRLARFFMAWGMPAAAIPV
FT                   LRVPMALYPPAPDLLLMRAQAARRAGRIKQAKALCEALRPTLEMAVLQQNLRQVLAIYV
FT                   EFEANMVRTSLAAGRYLSGLLCAENRRKLLLEACADLPEQPFIIQIRALCQALDGEYKE
FT                   AAGRITDLMRERGEHGRKSASKAELALLRETWTVVDRIAFANVDWAGDDVQTESSVLFE
FT                   RAQASETADALVAGKLLHEQLLQSREQEKFLALCQEDFDKAVALNVRLNAIRHMLRVGL
FT                   RRLPDYTPAHEQARQCLDAITPEIARQMQQVPRQKQLKSAYVNQMVTVLTLARTLRRAD
FT                   LAQRIVQHFVDLSEDPAANPVLWFAAANIANEVADQEQSRIIMDNTGHLPPQTQVHVRD
FT                   YFRWANLVGAYDEARKFSSTMPANLKRSFGMIQFVDTLPVRQRLRARRQDPRGISYPPL
FT                   AGAPPAKPSPHDADRRAGIPATHGAGAGQGAPATGSQGRHLHPGAQYQPVAQLSANGVA
FT                   GLQAAGLGRGAVGRRALAAREDRDRGDRYPERGDLP"
     MSTMTASLGR SWTERKWARR LFRGTPFRLA RFFMAWGMPA AAIPVLRVPM ALYPPAPDLL        60
     LMRAQAARRA GRIKQAKALC EALRPTLEMA VLQQNLRQVL AIYVEFEANM VRTSLAAGRY       120
     LSGLLCAENR RKLLLEACAD LPEQPFIIQI RALCQALDGE YKEAAGRITD LMRERGEHGR       180
     KSASKAELAL LRETWTVVDR IAFANVDWAG DDVQTESSVL FERAQASETA DALVAGKLLH       240
     EQLLQSREQE KFLALCQEDF DKAVALNVRL NAIRHMLRVG LRRLPDYTPA HEQARQCLDA       300
     ITPEIARQMQ QVPRQKQLKS AYVNQMVTVL TLARTLRRAD LAQRIVQHFV DLSEDPAANP       360
     VLWFAAANIA NEVADQEQSR IIMDNTGHLP PQTQVHVRDY FRWANLVGAY DEARKFSSTM       420
     PANLKRSFGM IQFVDTLPVR QRLRARRQDP RGISYPPLAG APPAKPSPHD ADRRAGIPAT       480
     HGAGAGQGAP ATGSQGRHLH PGAQYQPVAQ LSANGVAGLQ AAGLGRGAVG RRALAAREDR       540
     DRGDRYPERG DLP                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page