(data stored in SCRATCH zone)

EMBL: CP000509.PE1

CP000509.PE1         Location/Qualifiers
FT   CDS             72..1658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: fra:Francci3_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79551"
FT                   /db_xref="GOA:A1SCL6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCL6"
FT                   /protein_id="ABL79551.1"
FT                   /translation="MGIPGDGQDDREMTQKAGAVDQSTSDLGVAWRGVVNDLQPNQRAW
FT                   LRASEPVTLHESTAIVAVPNDFTRNQLEGRLRAQLEDALTVRFGREIRIAVTVNPQLED
FT                   APVAPGDRTDSATGRTDSGTDLAGGGHPEAPGQAPITRRTTQSLNRYDDMSTNSAAERS
FT                   AVVPVPPAPEPDLGARPSSLETRLNPKYTFETFVIGSSNRFPHAAAVAVAEAPGKAYNP
FT                   LLVYGDSGLGKTHLLHAIGHYVRSLYTGAKVRYVSSEEFTNEFINAIRDDRQDRFKRRY
FT                   RDVDVLLIDDIQFLEGKTQTQEEFFHTFNTLHNANKQIVLTSDRAPKRLEALEDRLRNR
FT                   FEWGLITDVQPPDLETRIAILRKKAAMDRLTAPPDVLEFIASKIQTNIRELEGALIRVT
FT                   AFANLNRQEVDMTLAEIVLKDLIPEGGEPEITAALIIAQTAAYFGLSIDELTGPSRGRH
FT                   LVMARQIAMYLCRELTDLSLPKIGAQFGNRDHTTVMYADRKINQLLAERRAVFNQVSEL
FT                   TNRVKLQARQS"
     MGIPGDGQDD REMTQKAGAV DQSTSDLGVA WRGVVNDLQP NQRAWLRASE PVTLHESTAI        60
     VAVPNDFTRN QLEGRLRAQL EDALTVRFGR EIRIAVTVNP QLEDAPVAPG DRTDSATGRT       120
     DSGTDLAGGG HPEAPGQAPI TRRTTQSLNR YDDMSTNSAA ERSAVVPVPP APEPDLGARP       180
     SSLETRLNPK YTFETFVIGS SNRFPHAAAV AVAEAPGKAY NPLLVYGDSG LGKTHLLHAI       240
     GHYVRSLYTG AKVRYVSSEE FTNEFINAIR DDRQDRFKRR YRDVDVLLID DIQFLEGKTQ       300
     TQEEFFHTFN TLHNANKQIV LTSDRAPKRL EALEDRLRNR FEWGLITDVQ PPDLETRIAI       360
     LRKKAAMDRL TAPPDVLEFI ASKIQTNIRE LEGALIRVTA FANLNRQEVD MTLAEIVLKD       420
     LIPEGGEPEI TAALIIAQTA AYFGLSIDEL TGPSRGRHLV MARQIAMYLC RELTDLSLPK       480
     IGAQFGNRDH TTVMYADRKI NQLLAERRAV FNQVSELTNR VKLQARQS                    528
//

If you have problems or comments...

PBIL Back to PBIL home page