(data stored in ACNUC1104 zone)

EMBL: CP000509.PE103

CP000509.PE103       Location/Qualifiers
FT   CDS             complement(120754..121770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0108"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   dge:Dgeo_2864 alcohol dehydrogenase GroES-like"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79653"
FT                   /db_xref="GOA:A1SCW8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW8"
FT                   /protein_id="ABL79653.1"
FT                   /translation="MPVAARLHSVGDLRVEQVAEPPAPTVGWSTVAVTSVGLCGSDLHW
FT                   FTDGGTGEVTLDRPVVPGHELAGRALDGPYAGRRVAIDPAIPCGVCEQCRAGHGNLCPD
FT                   VRFAGHAGLDGGLQERLVWPDHLLFPLPDDLSDDAGALLEPLGVAIHAVGVAHVRPGHD
FT                   VLVVGGGPIGVLTAAVARRTGAAQVVVSEPLAHRRETARRFGADVAVAPEEASSAVDEL
FT                   TGGRGVDVVIEMAGADDAIGTAVACARPGARIALGGIPSVPLSSFPAAPARRKGLTFAM
FT                   VRRMHETYPRAIELATSGIDLDALVSDRFPLADAPLAFTHAVARTGDKTVIAVSGTR"
     MPVAARLHSV GDLRVEQVAE PPAPTVGWST VAVTSVGLCG SDLHWFTDGG TGEVTLDRPV        60
     VPGHELAGRA LDGPYAGRRV AIDPAIPCGV CEQCRAGHGN LCPDVRFAGH AGLDGGLQER       120
     LVWPDHLLFP LPDDLSDDAG ALLEPLGVAI HAVGVAHVRP GHDVLVVGGG PIGVLTAAVA       180
     RRTGAAQVVV SEPLAHRRET ARRFGADVAV APEEASSAVD ELTGGRGVDV VIEMAGADDA       240
     IGTAVACARP GARIALGGIP SVPLSSFPAA PARRKGLTFA MVRRMHETYP RAIELATSGI       300
     DLDALVSDRF PLADAPLAFT HAVARTGDKT VIAVSGTR                               338
//

If you have problems or comments...

PBIL Back to PBIL home page