(data stored in ACNUC1104 zone)

EMBL: CP000509.PE104

CP000509.PE104       Location/Qualifiers
FT   CDS             121874..124267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO1740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79654"
FT                   /db_xref="GOA:A1SCW9"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW9"
FT                   /protein_id="ABL79654.1"
FT                   /translation="MAPRLVRPDPRAGRSRPRAWSLPRPPARRPRGPADRVARSRDSGE
FT                   PAAATRQTGTVDRPTLRRLFPRRVAIVCAAVLVVQGVGLALLVRDVREPRPHQVPVAVV
FT                   GPAVVAQGLAEQVNALEGRPLDVTASADREAAVDDVRHGLTVGAALIDLTGTQDQVVLD
FT                   GSTDERLARAVVEQARAIERSHGRTLSVRRVSMSDVDDDVVRGLAVGFGAVGFVVALAL
FT                   SLRFGPTARTLRLGTRRVLVVAAISLVSGYAATLLPGVSTLDTGAQLRLAGVLALTAAV
FT                   AGTVTLALEGVAGFGGLGLSAVFYLVVATPQLLGTDPHLLPAPWPVLSQWLPPGASVEA
FT                   LGAIALYGGTGIRLPLLVLAVWLLAAVLALQVSRRERVREQTAPDAGLDEPLLLHPPLT
FT                   PVVRHGRLVRWRWRVGVVVLPAAGAAFVLVSFVPRDAVADVAPVASRASETECVSTGTV
FT                   RSVADLNRMVRTVRGGPEFQGGDVGADTELQDGRRVMVFGDTLRSPSFAGQRFVRNSML
FT                   LIGGECIQAVVPEDHGALIPDRPSAQSAGRVGYWPMSAVTITHPGYDLVVVTAQRVRST
FT                   GIDDAFGFESLGPAVAVFVVPRGETPQLVAVRDVGPDAADVTRPEWGAAAVVEGEWLYL
FT                   YGTANPDQPYVFGFSLRVARVHPDDVLRPAAWEYWSGTDWVADPAQSRELIPAAGGTSQ
FT                   TLSVFRDGGQWHALSKRNEFLGSDVVVWTAPDPWGPFDGGRTVAPLPSDAAQGRLRYLP
FT                   LAHPGLLPEPGTVVVSFSRNRTDVDEVVADPTRYRPGFLRVDLP"
     MAPRLVRPDP RAGRSRPRAW SLPRPPARRP RGPADRVARS RDSGEPAAAT RQTGTVDRPT        60
     LRRLFPRRVA IVCAAVLVVQ GVGLALLVRD VREPRPHQVP VAVVGPAVVA QGLAEQVNAL       120
     EGRPLDVTAS ADREAAVDDV RHGLTVGAAL IDLTGTQDQV VLDGSTDERL ARAVVEQARA       180
     IERSHGRTLS VRRVSMSDVD DDVVRGLAVG FGAVGFVVAL ALSLRFGPTA RTLRLGTRRV       240
     LVVAAISLVS GYAATLLPGV STLDTGAQLR LAGVLALTAA VAGTVTLALE GVAGFGGLGL       300
     SAVFYLVVAT PQLLGTDPHL LPAPWPVLSQ WLPPGASVEA LGAIALYGGT GIRLPLLVLA       360
     VWLLAAVLAL QVSRRERVRE QTAPDAGLDE PLLLHPPLTP VVRHGRLVRW RWRVGVVVLP       420
     AAGAAFVLVS FVPRDAVADV APVASRASET ECVSTGTVRS VADLNRMVRT VRGGPEFQGG       480
     DVGADTELQD GRRVMVFGDT LRSPSFAGQR FVRNSMLLIG GECIQAVVPE DHGALIPDRP       540
     SAQSAGRVGY WPMSAVTITH PGYDLVVVTA QRVRSTGIDD AFGFESLGPA VAVFVVPRGE       600
     TPQLVAVRDV GPDAADVTRP EWGAAAVVEG EWLYLYGTAN PDQPYVFGFS LRVARVHPDD       660
     VLRPAAWEYW SGTDWVADPA QSRELIPAAG GTSQTLSVFR DGGQWHALSK RNEFLGSDVV       720
     VWTAPDPWGP FDGGRTVAPL PSDAAQGRLR YLPLAHPGLL PEPGTVVVSF SRNRTDVDEV       780
     VADPTRYRPG FLRVDLP                                                      797
//

If you have problems or comments...

PBIL Back to PBIL home page