(data stored in ACNUC1104 zone)

EMBL: CP000509.PE106

CP000509.PE106       Location/Qualifiers
FT   CDS             complement(124963..125349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79656"
FT                   /db_xref="GOA:A1SCX1"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX1"
FT                   /protein_id="ABL79656.1"
FT                   /translation="MGGHYPDPQPRMCSRTPLRRRDVVQATPPPRFRQGRRGKRDPQTA
FT                   PTGGPMTITALLMAGLMAFVLLVPTLMVAILVSGIARRPEPAEAAPVTGQATGPVTGPV
FT                   AVPVAVPVGARATVTRPTVELRAS"
     MGGHYPDPQP RMCSRTPLRR RDVVQATPPP RFRQGRRGKR DPQTAPTGGP MTITALLMAG        60
     LMAFVLLVPT LMVAILVSGI ARRPEPAEAA PVTGQATGPV TGPVAVPVAV PVGARATVTR       120
     PTVELRAS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page