(data stored in ACNUC1104 zone)

EMBL: CP000509.PE108

CP000509.PE108       Location/Qualifiers
FT   CDS             126048..127421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0113"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: amino acid-binding ACT domain protein; malic
FT                   enzyme domain protein; malic enzyme, NAD-binding; KEGG:
FT                   tfu:Tfu_2390 malate dehydrogenase (oxaloacetate
FT                   decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79658"
FT                   /db_xref="GOA:A1SCX3"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX3"
FT                   /protein_id="ABL79658.1"
FT                   /translation="MAATASSYSITMRLHTAPDHGVVGAVATAISAAGGIVTAIDVADS
FT                   SHARLVVDVTCSASDAEHAERLHAAAESVEGVAVHRVSDRTFLLHIGGKIEVTSKVPLR
FT                   NRDDLSMAYTPGVGRVSMALAESPGDVPRLTVKGNSVAVVTDGSAVLGLGNIGPGAALP
FT                   VMEGKAALFKRFADIDAWPICLASQDTDEIVRAVEMIAPGFGGINLEDIAAPRCFEIER
FT                   RLRESLDIPVFHDDQHGTAIVVLAALTNALRVVKKDITDVRIVVSGGGAAGTAIVTLLL
FT                   AAGAPDIVVWDREGCLSRDDDTLPPAKRQLAEMTNPRLVRGDLRAGLDGADVFIGVSGP
FT                   GVLDAEWIKDMAPDPVVFALANPDPEVDPAEAEKYAAVVASGRSDYPNQINNVLAFPGV
FT                   FRGLLDARASEITLDMLLRAAEAIALVVKDEELNPAFIIPTVFHPDVQRKVAAAVRGV"
     MAATASSYSI TMRLHTAPDH GVVGAVATAI SAAGGIVTAI DVADSSHARL VVDVTCSASD        60
     AEHAERLHAA AESVEGVAVH RVSDRTFLLH IGGKIEVTSK VPLRNRDDLS MAYTPGVGRV       120
     SMALAESPGD VPRLTVKGNS VAVVTDGSAV LGLGNIGPGA ALPVMEGKAA LFKRFADIDA       180
     WPICLASQDT DEIVRAVEMI APGFGGINLE DIAAPRCFEI ERRLRESLDI PVFHDDQHGT       240
     AIVVLAALTN ALRVVKKDIT DVRIVVSGGG AAGTAIVTLL LAAGAPDIVV WDREGCLSRD       300
     DDTLPPAKRQ LAEMTNPRLV RGDLRAGLDG ADVFIGVSGP GVLDAEWIKD MAPDPVVFAL       360
     ANPDPEVDPA EAEKYAAVVA SGRSDYPNQI NNVLAFPGVF RGLLDARASE ITLDMLLRAA       420
     EAIALVVKDE ELNPAFIIPT VFHPDVQRKV AAAVRGV                                457
//

If you have problems or comments...

PBIL Back to PBIL home page