(data stored in SCRATCH zone)

EMBL: CP000509.PE11

CP000509.PE11        Location/Qualifiers
FT   CDS             complement(14712..15461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0011"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mmc:Mmcs_2727 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79561"
FT                   /db_xref="GOA:A1SCM6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM6"
FT                   /protein_id="ABL79561.1"
FT                   /translation="MPTLPGMPLQPVNRRSVPDEVFDQVLSEVVDGGIGAGEALPSERR
FT                   LAEVLGVSRPAVREALQRMAQTRLLDVRHGGATTVRDFRRYGGLDLLPRLLVRRGELDP
FT                   AVARSILEARLVVGPGVAALAAERGGPALEPVLAETVAALEGTEDGIERQRHALAFWDL
FT                   VVDAADSMVFRLMFNSLRAAYEPALEALAALMAEEVGQVGAYRLLTAAIGAGDPETARA
FT                   AADRVLRPATTSLLTALAALDSDQEDS"
     MPTLPGMPLQ PVNRRSVPDE VFDQVLSEVV DGGIGAGEAL PSERRLAEVL GVSRPAVREA        60
     LQRMAQTRLL DVRHGGATTV RDFRRYGGLD LLPRLLVRRG ELDPAVARSI LEARLVVGPG       120
     VAALAAERGG PALEPVLAET VAALEGTEDG IERQRHALAF WDLVVDAADS MVFRLMFNSL       180
     RAAYEPALEA LAALMAEEVG QVGAYRLLTA AIGAGDPETA RAAADRVLRP ATTSLLTALA       240
     ALDSDQEDS                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page