(data stored in ACNUC1104 zone)

EMBL: CP000509.PE110

CP000509.PE110       Location/Qualifiers
FT   CDS             129511..130020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0115"
FT                   /product="regulatory protein, MarR"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: rxy:Rxyl_1740
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79660"
FT                   /db_xref="GOA:A1SCX5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX5"
FT                   /protein_id="ABL79660.1"
FT                   /translation="MAKPERAGPASEFADAWRQTGSLVALREAIEAGARVRHVVARRAG
FT                   LSDSELVALQHLVRTSLGPAELARILDISTAASTGVVDRLAERGHVERHPHAEDRRRTD
FT                   VRVTASGREEVLAHLLPMFTALDAWDRSFTEAERALVERYLRGVRAAFEQVFDPPVIAQ
FT                   PPPSEA"
     MAKPERAGPA SEFADAWRQT GSLVALREAI EAGARVRHVV ARRAGLSDSE LVALQHLVRT        60
     SLGPAELARI LDISTAASTG VVDRLAERGH VERHPHAEDR RRTDVRVTAS GREEVLAHLL       120
     PMFTALDAWD RSFTEAERAL VERYLRGVRA AFEQVFDPPV IAQPPPSEA                   169
//

If you have problems or comments...

PBIL Back to PBIL home page