(data stored in SCRATCH zone)

EMBL: CP000509.PE111

CP000509.PE111       Location/Qualifiers
FT   CDS             complement(129996..130754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0116"
FT                   /product="Polyphosphate glucokinase"
FT                   /EC_number="2.7.1.63"
FT                   /note="PFAM: ROK family protein; KEGG: lxx:Lxx09960
FT                   glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79661"
FT                   /db_xref="GOA:A1SCX6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX6"
FT                   /protein_id="ABL79661.1"
FT                   /translation="MAQTAPQPFGIDFGGTGIKGAPVDLEAGDFAAERVRIRTPDPSTP
FT                   ERVAAVFVELLRRFPDSTGAVGVTVPGVVRHGVVRSAANIDRAWVGTDADRLFTRATGR
FT                   EVHVVNDADGAGLAEVRYGAAKGRSGLVIVTTLGTGIGSAMVYDGVLVPNSELGHLEVE
FT                   GHDAESRAANSAREREDLSWEQWAKRLTTYYRTLERLFSPELFVVGGGVSKSSAEFLAL
FT                   VDIDTEIIPAALLNKAGVVGAALYASEGGG"
     MAQTAPQPFG IDFGGTGIKG APVDLEAGDF AAERVRIRTP DPSTPERVAA VFVELLRRFP        60
     DSTGAVGVTV PGVVRHGVVR SAANIDRAWV GTDADRLFTR ATGREVHVVN DADGAGLAEV       120
     RYGAAKGRSG LVIVTTLGTG IGSAMVYDGV LVPNSELGHL EVEGHDAESR AANSARERED       180
     LSWEQWAKRL TTYYRTLERL FSPELFVVGG GVSKSSAEFL ALVDIDTEII PAALLNKAGV       240
     VGAALYASEG GG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page