(data stored in ACNUC1104 zone)

EMBL: CP000509.PE112

CP000509.PE112       Location/Qualifiers
FT   CDS             130799..131413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0117"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: nfa:nfa31300 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79662"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX7"
FT                   /protein_id="ABL79662.1"
FT                   /translation="MLLLGAVALFEPVNGYQIRRELLSWQVDRWAHTNPGSIYHGLTSL
FT                   TGLGHLVRHDLVDGGREVAVYELTGSGRAELERLMVEALETVNPYERSAFTVAFSMLPL
FT                   LDRDRVLRSLTRRRVDLEQTVAELAAANPGVAPPHATRSMLLWLDLAVAELAWLRETIE
FT                   DIRAGKLPFEMDDDWGWTPPADDPGWQMSTDREKYRALLGR"
     MLLLGAVALF EPVNGYQIRR ELLSWQVDRW AHTNPGSIYH GLTSLTGLGH LVRHDLVDGG        60
     REVAVYELTG SGRAELERLM VEALETVNPY ERSAFTVAFS MLPLLDRDRV LRSLTRRRVD       120
     LEQTVAELAA ANPGVAPPHA TRSMLLWLDL AVAELAWLRE TIEDIRAGKL PFEMDDDWGW       180
     TPPADDPGWQ MSTDREKYRA LLGR                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page