(data stored in ACNUC1104 zone)

EMBL: CP000509.PE113

CP000509.PE113       Location/Qualifiers
FT   CDS             complement(131399..132259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0118"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   dvu:DVU0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79663"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX8"
FT                   /protein_id="ABL79663.1"
FT                   /translation="MTEPADVRLAVLIDADNVSASHAADLLAELARYGVPTVKRAYGDW
FT                   TTQQLAGWKSELARHAIQPIQQFANTVGKNSTDSALIIDAMDLLYSGHLDAFAIVSSDS
FT                   DFTRLATRLRESGKTVYGLGRRRTPASLQAACDKFIFLEVLRDGEGGGADQAHQKEAAP
FT                   GSEHEADADAEADSLPDLRTILEAAVRSTAQDDGWSALGSVGSYLGKTHAAFDPRHYGF
FT                   PRLSALAGAQPYLDLDHPDGGQPRVRLRSQRPPRKRAAAKKAGSQNEPAKKTTKKGAAR
FT                   DSATE"
     MTEPADVRLA VLIDADNVSA SHAADLLAEL ARYGVPTVKR AYGDWTTQQL AGWKSELARH        60
     AIQPIQQFAN TVGKNSTDSA LIIDAMDLLY SGHLDAFAIV SSDSDFTRLA TRLRESGKTV       120
     YGLGRRRTPA SLQAACDKFI FLEVLRDGEG GGADQAHQKE AAPGSEHEAD ADAEADSLPD       180
     LRTILEAAVR STAQDDGWSA LGSVGSYLGK THAAFDPRHY GFPRLSALAG AQPYLDLDHP       240
     DGGQPRVRLR SQRPPRKRAA AKKAGSQNEP AKKTTKKGAA RDSATE                      286
//

If you have problems or comments...

PBIL Back to PBIL home page