(data stored in ACNUC1104 zone)

EMBL: CP000509.PE114

CP000509.PE114       Location/Qualifiers
FT   CDS             132342..133082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0119"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   sco:SCO1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79664"
FT                   /db_xref="GOA:A1SCX9"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX9"
FT                   /protein_id="ABL79664.1"
FT                   /translation="MSRHLDAIRSAMVAFVRYAERAGLGAPVPTCPDWTVRDLVAHQGM
FT                   VHRWATALVRGEHDVDPDAFEAAGRAAADPLEWLRDGAVALADELTRAPADLHALVFLH
FT                   DAPAPREFWARRQCHETTVHGVDALAAALGRWPTAEDTWIEPDLAVDGIDELPGGFLTR
FT                   PRSRLRCEEEALLVVAPDDAPDRWLVHLGPGPAVTERRVGPVFADADWQLDGSAVSLYL
FT                   ALWNRTRRPGLDAGWRDRAAVTWG"
     MSRHLDAIRS AMVAFVRYAE RAGLGAPVPT CPDWTVRDLV AHQGMVHRWA TALVRGEHDV        60
     DPDAFEAAGR AAADPLEWLR DGAVALADEL TRAPADLHAL VFLHDAPAPR EFWARRQCHE       120
     TTVHGVDALA AALGRWPTAE DTWIEPDLAV DGIDELPGGF LTRPRSRLRC EEEALLVVAP       180
     DDAPDRWLVH LGPGPAVTER RVGPVFADAD WQLDGSAVSL YLALWNRTRR PGLDAGWRDR       240
     AAVTWG                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page