(data stored in ACNUC1104 zone)

EMBL: CP000509.PE116

CP000509.PE116       Location/Qualifiers
FT   CDS             134268..135026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0121"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sco:SCO5382
FT                   putative ABC transporter, integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79666"
FT                   /db_xref="GOA:A1SCY1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY1"
FT                   /protein_id="ABL79666.1"
FT                   /translation="MFLRESSIVFRRQIRMNLRNPAWVLIGILQPVLYLLLFGPLLKPL
FT                   VGSFDTGTANAYTFLVPGLLVQLGMFGAFFAGFALIGEWREGVIEAERVTPASRSALLV
FT                   GRLMRDVLQLLVQALILVGLGLAMGLRGSAVGIGLGIVITLLIGGACAAASNALALTTK
FT                   SEDVMAPVINIVMMPVLLLSGILLPMTLGPAWLERASDLMPFRYVVDAVRDGFAGDVAS
FT                   SAVLWGLVWSVALAALGGWWGTATFRRENA"
     MFLRESSIVF RRQIRMNLRN PAWVLIGILQ PVLYLLLFGP LLKPLVGSFD TGTANAYTFL        60
     VPGLLVQLGM FGAFFAGFAL IGEWREGVIE AERVTPASRS ALLVGRLMRD VLQLLVQALI       120
     LVGLGLAMGL RGSAVGIGLG IVITLLIGGA CAAASNALAL TTKSEDVMAP VINIVMMPVL       180
     LLSGILLPMT LGPAWLERAS DLMPFRYVVD AVRDGFAGDV ASSAVLWGLV WSVALAALGG       240
     WWGTATFRRE NA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page