(data stored in ACNUC1104 zone)

EMBL: CP000509.PE118

CP000509.PE118       Location/Qualifiers
FT   CDS             136857..137420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0123"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_3220
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79668"
FT                   /db_xref="GOA:A1SCY3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY3"
FT                   /protein_id="ABL79668.1"
FT                   /translation="MPGTTRSRIVDAAVAMTVESGWARVTMGALAERVGVSRQTVYNEV
FT                   GTKPGLAEAMIHQELDRFLGVVSEAFDRHPDDLVDAIRAASSGVLELAQDNRLLHAVVS
FT                   ATHGADTELLPLLTTHAESLLAAAKLVVADRLAPYSLGIEGRRLAAAIDVVVRVVLSHV
FT                   MQPSGSPADTADDIAWIAARVLRG"
     MPGTTRSRIV DAAVAMTVES GWARVTMGAL AERVGVSRQT VYNEVGTKPG LAEAMIHQEL        60
     DRFLGVVSEA FDRHPDDLVD AIRAASSGVL ELAQDNRLLH AVVSATHGAD TELLPLLTTH       120
     AESLLAAAKL VVADRLAPYS LGIEGRRLAA AIDVVVRVVL SHVMQPSGSP ADTADDIAWI       180
     AARVLRG                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page