(data stored in ACNUC1104 zone)

EMBL: CP000509.PE122

CP000509.PE122       Location/Qualifiers
FT   CDS             complement(139877..140725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0127"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: bte:BTH_I0496 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79672"
FT                   /db_xref="GOA:A1SCY7"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY7"
FT                   /protein_id="ABL79672.1"
FT                   /translation="MSELVLILSCPDRPGIVHAVTGFLVERGANITESQQFGDPLSGRF
FT                   FMRIAVDVPGAVDAAALRAEFAPVAEEFEMRFDVHDAAAPYRTLILVSKDLHCLNDLLF
FT                   RTSTGSLGIEVPAIVSNHPDAAAMAASYGVPFHHVPVTPDTKAQAEERLLELVRELDID
FT                   LVVLARYMQILSDGLCRELSGKAINIHHSFLPSFKGARPYHQAFDRGVKLVGATAHYVT
FT                   SDLDEGPIIEQDVMRVDHTHHQEQLVSAGRDVEAQVLSRAVRWHAQSRVLLNGHRTVVF
FT                   R"
     MSELVLILSC PDRPGIVHAV TGFLVERGAN ITESQQFGDP LSGRFFMRIA VDVPGAVDAA        60
     ALRAEFAPVA EEFEMRFDVH DAAAPYRTLI LVSKDLHCLN DLLFRTSTGS LGIEVPAIVS       120
     NHPDAAAMAA SYGVPFHHVP VTPDTKAQAE ERLLELVREL DIDLVVLARY MQILSDGLCR       180
     ELSGKAINIH HSFLPSFKGA RPYHQAFDRG VKLVGATAHY VTSDLDEGPI IEQDVMRVDH       240
     THHQEQLVSA GRDVEAQVLS RAVRWHAQSR VLLNGHRTVV FR                          282
//

If you have problems or comments...

PBIL Back to PBIL home page