(data stored in ACNUC1104 zone)

EMBL: CP000509.PE123

CP000509.PE123       Location/Qualifiers
FT   CDS             140747..142054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_2367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79673"
FT                   /db_xref="GOA:A1SCY8"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY8"
FT                   /protein_id="ABL79673.1"
FT                   /translation="MGRPGRTALRADRRRRLTTYPGPGRDVMRVRRARSTAVLGLAALL
FT                   GALTTACTGPSEAGDPTPDSSSTATASAGSPTASPALDPAHAVDPPGRRTGLISPPDIV
FT                   ASGSKTIAPGRVRAIERLAGVVDVEQVSLVQVVVENRALSVAAVDPTTYRNFVVNADSA
FT                   KADDVWDRVAGGELALRPALQKRAPIDENGFLKLGSAEDAPQVHVGAYAQQSWLVDAVV
FT                   NETWIPTLGMTEGNALLIRTGGTSPETLRAPIQRILRGTGAAPQMTDVVAREGLDPGAV
FT                   QTVVVVGSIADAIGTFRYSVLAGGRIAPDPAWVASHIATRTVPILGTVTCNRLMFPQLE
FT                   AALRDVVAQGLTDKIHPGEYAGCYYPRFIAGSTTLSNHAFGLALDLNVPGNQRGTVGQI
FT                   DRGVVAIFKHWGFTWGGDWRYTDPMHFEMNRLVEPR"
     MGRPGRTALR ADRRRRLTTY PGPGRDVMRV RRARSTAVLG LAALLGALTT ACTGPSEAGD        60
     PTPDSSSTAT ASAGSPTASP ALDPAHAVDP PGRRTGLISP PDIVASGSKT IAPGRVRAIE       120
     RLAGVVDVEQ VSLVQVVVEN RALSVAAVDP TTYRNFVVNA DSAKADDVWD RVAGGELALR       180
     PALQKRAPID ENGFLKLGSA EDAPQVHVGA YAQQSWLVDA VVNETWIPTL GMTEGNALLI       240
     RTGGTSPETL RAPIQRILRG TGAAPQMTDV VAREGLDPGA VQTVVVVGSI ADAIGTFRYS       300
     VLAGGRIAPD PAWVASHIAT RTVPILGTVT CNRLMFPQLE AALRDVVAQG LTDKIHPGEY       360
     AGCYYPRFIA GSTTLSNHAF GLALDLNVPG NQRGTVGQID RGVVAIFKHW GFTWGGDWRY       420
     TDPMHFEMNR LVEPR                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page