(data stored in ACNUC1104 zone)

EMBL: CP000509.PE125

CP000509.PE125       Location/Qualifiers
FT   CDS             142477..143439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0130"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_1554 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79675"
FT                   /db_xref="GOA:A1SCZ0"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ0"
FT                   /protein_id="ABL79675.1"
FT                   /translation="MRAAQVIDTTGPADVVVRDVPEPTPGPDDVLVEVHRVGISFPDLL
FT                   LSKGEYQLKPEVPFTLGVDFAGTVVSGGPFEPGQRVAGVNGYGGAAELVVNPAQFTFAL
FT                   PDHVTFDEGAALPMNYLTAQFALAERGGLRAGETVLVHGAAGGVGTASIQVAKGYGART
FT                   IAVVSTEEKAEVARAAGADAAVLLEGFKDAVLQLTDGRGVDVVVDVVGGSAFTDSLRCL
FT                   APQGRLLVVGFAAGQGIPEVRVNRLLLNNVDVRGVGWGAYAMTRPGYLQDQWAALLPML
FT                   ESGVVKPPIGATYDLDEVTRALVDMDERRTLGKSVLRVR"
     MRAAQVIDTT GPADVVVRDV PEPTPGPDDV LVEVHRVGIS FPDLLLSKGE YQLKPEVPFT        60
     LGVDFAGTVV SGGPFEPGQR VAGVNGYGGA AELVVNPAQF TFALPDHVTF DEGAALPMNY       120
     LTAQFALAER GGLRAGETVL VHGAAGGVGT ASIQVAKGYG ARTIAVVSTE EKAEVARAAG       180
     ADAAVLLEGF KDAVLQLTDG RGVDVVVDVV GGSAFTDSLR CLAPQGRLLV VGFAAGQGIP       240
     EVRVNRLLLN NVDVRGVGWG AYAMTRPGYL QDQWAALLPM LESGVVKPPI GATYDLDEVT       300
     RALVDMDERR TLGKSVLRVR                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page