(data stored in ACNUC1104 zone)

EMBL: CP000509.PE127

CP000509.PE127       Location/Qualifiers
FT   CDS             complement(145778..146350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79677"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ2"
FT                   /protein_id="ABL79677.1"
FT                   /translation="MSNHRTLAFAAVASLATLGLVGGATTTSSADADGFAPHVGQRVAA
FT                   KATAPVKCGGGALKKMTSRLSAEPFSFAGTAGADVAVTGAQVALTGPPKGTDTVLVTFT
FT                   AESYYTGSGWMSLELHKDGVPAAPYADNGSPFAFTSEASYHGDSAQFCTKIGTGTHVLA
FT                   IQASTTGNSSTDSGWIDDWTMSVPRFE"
     MSNHRTLAFA AVASLATLGL VGGATTTSSA DADGFAPHVG QRVAAKATAP VKCGGGALKK        60
     MTSRLSAEPF SFAGTAGADV AVTGAQVALT GPPKGTDTVL VTFTAESYYT GSGWMSLELH       120
     KDGVPAAPYA DNGSPFAFTS EASYHGDSAQ FCTKIGTGTH VLAIQASTTG NSSTDSGWID       180
     DWTMSVPRFE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page