(data stored in ACNUC1104 zone)

EMBL: CP000509.PE129

CP000509.PE129       Location/Qualifiers
FT   CDS             148881..149261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79679"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ4"
FT                   /protein_id="ABL79679.1"
FT                   /translation="MAEGATNRVAADKEYLDEYGFRGRLQQRVDGLTYAVAGLLTAAPE
FT                   PQELLESVRAAADRGTRFLLVAAGDVETEGLAAQRLLTAAPDLVEVWTVPGAGHVQGLR
FT                   TDPEGWSQRVVGFLDAALVGPR"
     MAEGATNRVA ADKEYLDEYG FRGRLQQRVD GLTYAVAGLL TAAPEPQELL ESVRAAADRG        60
     TRFLLVAAGD VETEGLAAQR LLTAAPDLVE VWTVPGAGHV QGLRTDPEGW SQRVVGFLDA       120
     ALVGPR                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page