(data stored in ACNUC1104 zone)

EMBL: CP000509.PE13

CP000509.PE13        Location/Qualifiers
FT   CDS             16324..16671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV2833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79563"
FT                   /db_xref="GOA:A1SCM8"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM8"
FT                   /protein_id="ABL79563.1"
FT                   /translation="MKNLFNTYRVLATIVGVLLAFASLVAAPLKYLATEDSGLQRFGES
FT                   ASIVWLVHGWVFMIYVVVAFLLARRARWTIGFTVLMLVAGLIPLLIFWVERRVTRKVRV
FT                   ENPELVGSTAG"
     MKNLFNTYRV LATIVGVLLA FASLVAAPLK YLATEDSGLQ RFGESASIVW LVHGWVFMIY        60
     VVVAFLLARR ARWTIGFTVL MLVAGLIPLL IFWVERRVTR KVRVENPELV GSTAG            115
//

If you have problems or comments...

PBIL Back to PBIL home page