(data stored in ACNUC1104 zone)

EMBL: CP000509.PE133

CP000509.PE133       Location/Qualifiers
FT   CDS             152214..154925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0138"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: sco:SCO1167
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79683"
FT                   /db_xref="GOA:A1SCZ8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ8"
FT                   /protein_id="ABL79683.1"
FT                   /translation="MSFVPVTGPATFRAADPPREGVVEFTDDRRTVSLPIRAALPVLTK
FT                   ARSRDDLHPSVGVLSGAALLALRLVAAGKFAPAGSSPPAWRVAGLDADDEQRIVLLARN
FT                   GPDDEQLVRDLLDAVADAMPRTQPRTQPRSRPSAEPSGTTVSRERRPTFEERLQARLAR
FT                   HQRVDARALPQLVTISLRVEADEEELVAGAVRLVAQAHDEQNPLHLCDLALLWTGTPQE
FT                   HGFGERARTHATIALRAAADAWPVLDRLLELRVPDQLTLDSDELVSLLDEGVGALRAAG
FT                   VDVLWPKALGRDLTATTVLDRAAPMTREEPLNEPVLGAEALFAFNWQIALHGDPLTAEE
FT                   MDRLATSASPLLRLRGSWTVVDPSIARKAKKRLVRTVKPAEAVAAALTGTAQIAAPGGE
FT                   QSEQDVVVGASLLKVRDRLLGAATREPVEPPAALRATLRDYQRHGLTWLAEMTSLGLGA
FT                   CLADDMGLGKTVTLIALHLHRAERGHRGPTLVVCPASLLGNWEAEVRRFAPGVPVVRFH
FT                   GTSRDVEAAGDGFVLTTYGTMRRDAEALGSVRWDLVVADEAQHVKNPRTATARALRSIT
FT                   SAARVALTGTPVENDLTELWAILDWTTPGLLGSRNAFRKAWAAPIESGREPAKARQFAD
FT                   LIGPFLLRRRKSDPGIAPELPAKTETDHPLRLTREQVVLYESFVRDTMARIERADPSDP
FT                   VARRGLVLTLLTGLKQICNHPDHFLKRSGARLSGRSEKVDLLDELVGTVLAEDGAVLVF
FT                   TQYVAMARLLEGHLARAGVPHQLLHGGTPVREREAMVARFQAGETPVFLLSLKAGGTGL
FT                   NLTRADHVVHVDRWWNPAVEEQATDRAYRIGQTKPVQVHRMITRGTVEEKVAELLTRKR
FT                   ALADAVLSRGEAALTELSDDELRDFVALRRDP"
     MSFVPVTGPA TFRAADPPRE GVVEFTDDRR TVSLPIRAAL PVLTKARSRD DLHPSVGVLS        60
     GAALLALRLV AAGKFAPAGS SPPAWRVAGL DADDEQRIVL LARNGPDDEQ LVRDLLDAVA       120
     DAMPRTQPRT QPRSRPSAEP SGTTVSRERR PTFEERLQAR LARHQRVDAR ALPQLVTISL       180
     RVEADEEELV AGAVRLVAQA HDEQNPLHLC DLALLWTGTP QEHGFGERAR THATIALRAA       240
     ADAWPVLDRL LELRVPDQLT LDSDELVSLL DEGVGALRAA GVDVLWPKAL GRDLTATTVL       300
     DRAAPMTREE PLNEPVLGAE ALFAFNWQIA LHGDPLTAEE MDRLATSASP LLRLRGSWTV       360
     VDPSIARKAK KRLVRTVKPA EAVAAALTGT AQIAAPGGEQ SEQDVVVGAS LLKVRDRLLG       420
     AATREPVEPP AALRATLRDY QRHGLTWLAE MTSLGLGACL ADDMGLGKTV TLIALHLHRA       480
     ERGHRGPTLV VCPASLLGNW EAEVRRFAPG VPVVRFHGTS RDVEAAGDGF VLTTYGTMRR       540
     DAEALGSVRW DLVVADEAQH VKNPRTATAR ALRSITSAAR VALTGTPVEN DLTELWAILD       600
     WTTPGLLGSR NAFRKAWAAP IESGREPAKA RQFADLIGPF LLRRRKSDPG IAPELPAKTE       660
     TDHPLRLTRE QVVLYESFVR DTMARIERAD PSDPVARRGL VLTLLTGLKQ ICNHPDHFLK       720
     RSGARLSGRS EKVDLLDELV GTVLAEDGAV LVFTQYVAMA RLLEGHLARA GVPHQLLHGG       780
     TPVREREAMV ARFQAGETPV FLLSLKAGGT GLNLTRADHV VHVDRWWNPA VEEQATDRAY       840
     RIGQTKPVQV HRMITRGTVE EKVAELLTRK RALADAVLSR GEAALTELSD DELRDFVALR       900
     RDP                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page