(data stored in ACNUC1104 zone)

EMBL: CP000509.PE135

CP000509.PE135       Location/Qualifiers
FT   CDS             complement(155620..156168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0140"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   fra:Francci3_2248 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79685"
FT                   /db_xref="GOA:A1SD00"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD00"
FT                   /protein_id="ABL79685.1"
FT                   /translation="MSRRDQILATAAELFAAHGYHGVSVADLGAACGISGPALYKHFAS
FT                   KQAVLAEMLVAISEELLRVGTERVAAATGPRTAIAALVDWHVDFALRHRALIVVQDRDW
FT                   EALPEEARERVRTLQREYVDLWAAQLRLADPRLDLATARAMAHAAFGLINSTPHSGLLP
FT                   DTDMRGLLSRMALGALGAG"
     MSRRDQILAT AAELFAAHGY HGVSVADLGA ACGISGPALY KHFASKQAVL AEMLVAISEE        60
     LLRVGTERVA AATGPRTAIA ALVDWHVDFA LRHRALIVVQ DRDWEALPEE ARERVRTLQR       120
     EYVDLWAAQL RLADPRLDLA TARAMAHAAF GLINSTPHSG LLPDTDMRGL LSRMALGALG       180
     AG                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page