(data stored in ACNUC1104 zone)

EMBL: CP000509.PE136

CP000509.PE136       Location/Qualifiers
FT   CDS             complement(156321..156584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0141"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   cef:CE0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79686"
FT                   /db_xref="GOA:A1SD01"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD01"
FT                   /protein_id="ABL79686.1"
FT                   /translation="MELDPQEMTPVINRIKRAQGQLAGVLRMLEEGRECEDVVTQLAAV
FT                   SRALDRAGFAIVATGLQQCLTTGDGLDSLDAKKMEKLFLSLA"
     MELDPQEMTP VINRIKRAQG QLAGVLRMLE EGRECEDVVT QLAAVSRALD RAGFAIVATG        60
     LQQCLTTGDG LDSLDAKKME KLFLSLA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page