(data stored in SCRATCH zone)

EMBL: CP000509.PE138

CP000509.PE138       Location/Qualifiers
FT   CDS             complement(156987..157367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0143"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: nfa:nfa18780 putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79688"
FT                   /db_xref="GOA:A1SD03"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD03"
FT                   /protein_id="ABL79688.1"
FT                   /translation="MTTTTLTAAQFEETVTGNDIVLVDFWASWCGPCRQFAPVFEAASE
FT                   KHPDVVFGKVDTEAERELAAAAQITSIPTLMAFREGVLVFAQPGALPATSLEQVIGAVR
FT                   ELDMDDVRAQLAAQSQDQEENQ"
     MTTTTLTAAQ FEETVTGNDI VLVDFWASWC GPCRQFAPVF EAASEKHPDV VFGKVDTEAE        60
     RELAAAAQIT SIPTLMAFRE GVLVFAQPGA LPATSLEQVI GAVRELDMDD VRAQLAAQSQ       120
     DQEENQ                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page