(data stored in ACNUC1104 zone)

EMBL: CP000509.PE142

CP000509.PE142       Location/Qualifiers
FT   CDS             161748..163259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0147"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: sco:SCO2776
FT                   acetyl/propionyl CoA carboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79692"
FT                   /db_xref="GOA:A1SD07"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD07"
FT                   /protein_id="ABL79692.1"
FT                   /translation="MKELVDELRERLATARQGGSEKARRKHTDRGKLLVRDRVDRLLDP
FT                   GSPFLELSPLAADGMYGGAVPSAGVVTGIGRVSGREVVVVANDATVKGGTYYPMTVKKH
FT                   LRAQTVAADNRLPCVYLVDSGGAFLPMQDEVFPDREHFGRIFFNQANLSARGIPQIASV
FT                   MGSCTAGGAYVPAMSDETVIVRNQGTIFLGGPPLVKAATGEVVTAEELGGGDVHARTSG
FT                   VADHLAEDDAHALAIVRSIVETVGPRAAAPWEVHPVEEPHEDPTSLYDVIPADTRTPYD
FT                   VREVIRRVVDGSRFHEFKKLYGETLVTGFARVWGHPVGIVANNGILFSESSLKGAHFIE
FT                   LCNQRGIPLVFLQNITGFMVGKEYENGGIAKDGAKLVTAVACSVVPKFTVVIGGSFGAG
FT                   NYGMCGRAYDPRFLWMWPNARISVMGGEQAASVLATVAGRPDDEEFKAPIREQYETQGS
FT                   PYYSTARLWDDGIIDPADTRRVLGMGLAAAANAPVPAPTYGIFRM"
     MKELVDELRE RLATARQGGS EKARRKHTDR GKLLVRDRVD RLLDPGSPFL ELSPLAADGM        60
     YGGAVPSAGV VTGIGRVSGR EVVVVANDAT VKGGTYYPMT VKKHLRAQTV AADNRLPCVY       120
     LVDSGGAFLP MQDEVFPDRE HFGRIFFNQA NLSARGIPQI ASVMGSCTAG GAYVPAMSDE       180
     TVIVRNQGTI FLGGPPLVKA ATGEVVTAEE LGGGDVHART SGVADHLAED DAHALAIVRS       240
     IVETVGPRAA APWEVHPVEE PHEDPTSLYD VIPADTRTPY DVREVIRRVV DGSRFHEFKK       300
     LYGETLVTGF ARVWGHPVGI VANNGILFSE SSLKGAHFIE LCNQRGIPLV FLQNITGFMV       360
     GKEYENGGIA KDGAKLVTAV ACSVVPKFTV VIGGSFGAGN YGMCGRAYDP RFLWMWPNAR       420
     ISVMGGEQAA SVLATVAGRP DDEEFKAPIR EQYETQGSPY YSTARLWDDG IIDPADTRRV       480
     LGMGLAAAAN APVPAPTYGI FRM                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page