(data stored in SCRATCH zone)

EMBL: CP000509.PE145

CP000509.PE145       Location/Qualifiers
FT   CDS             166369..167466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syd:Syncc9605_2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79695"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD10"
FT                   /protein_id="ABL79695.1"
FT                   /translation="MSRKVYLHIGAPKTGTTYLQDRLTVNAKTLAAQGVHFPTGSPLVS
FT                   PGLYQFRAALDLLGQDWGGPPGHADGSWEGLVRRARRRSGTVVISHEILAPAAPGQVAR
FT                   AMRDLAGSEIHVVYTARDLARQLPAAWQESIKQGRRWSYRRFLDRFEKGRSWFYRAFDV
FT                   PRVLGTWGAGLPPERVHVVTVPHARVQTQHGDQLWLRMCEVLGIDPVWAPLDSDRSNRS
FT                   LGIAETQVIRQLNRRMDRAARRESTYDALIRDMLAQGELVKRESAAVRLPPERFAWVEE
FT                   RAERWIEWIEGSGVHVVGDVAELRPVRPAEDERWRDPDRVRAKRQLATALDALAAMTRE
FT                   AARRPDPERQLTTRVLAQAQRLRDR"
     MSRKVYLHIG APKTGTTYLQ DRLTVNAKTL AAQGVHFPTG SPLVSPGLYQ FRAALDLLGQ        60
     DWGGPPGHAD GSWEGLVRRA RRRSGTVVIS HEILAPAAPG QVARAMRDLA GSEIHVVYTA       120
     RDLARQLPAA WQESIKQGRR WSYRRFLDRF EKGRSWFYRA FDVPRVLGTW GAGLPPERVH       180
     VVTVPHARVQ TQHGDQLWLR MCEVLGIDPV WAPLDSDRSN RSLGIAETQV IRQLNRRMDR       240
     AARRESTYDA LIRDMLAQGE LVKRESAAVR LPPERFAWVE ERAERWIEWI EGSGVHVVGD       300
     VAELRPVRPA EDERWRDPDR VRAKRQLATA LDALAAMTRE AARRPDPERQ LTTRVLAQAQ       360
     RLRDR                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page