(data stored in ACNUC1104 zone)

EMBL: CP000509.PE149

CP000509.PE149       Location/Qualifiers
FT   CDS             170563..171246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0154"
FT                   /product="Leucyltransferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="PFAM: leucyl/phenylalanyl-tRNA--protein transferase;
FT                   KEGG: pac:PPA2221 leucyl/phenylalanyl-tRNA-protein
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79699"
FT                   /db_xref="GOA:A1SD14"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD14"
FT                   /protein_id="ABL79699.1"
FT                   /translation="MGADLEPGTLLAAYRRGLFPMPSGRPGDPMAWFCPVRRGVVPLDG
FT                   LRVSRSLRRATRDFEIRIDTAFDQVVAGCADPRRSGGWIDEEVGAAYAALHQLGWAHSV
FT                   EAWRHGRLAGGLYGVAIGGLFAGESMFHRQRDASKVALVALVEALNDEWTADRLLDVQW
FT                   LTPHLASLGAVEVPRPTYLRRLARALPLPLPEPFSSVAPTPGGWSMGAPAGPEPDGPPR
FT                   RETDR"
     MGADLEPGTL LAAYRRGLFP MPSGRPGDPM AWFCPVRRGV VPLDGLRVSR SLRRATRDFE        60
     IRIDTAFDQV VAGCADPRRS GGWIDEEVGA AYAALHQLGW AHSVEAWRHG RLAGGLYGVA       120
     IGGLFAGESM FHRQRDASKV ALVALVEALN DEWTADRLLD VQWLTPHLAS LGAVEVPRPT       180
     YLRRLARALP LPLPEPFSSV APTPGGWSMG APAGPEPDGP PRRETDR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page