(data stored in SCRATCH zone)

EMBL: CP000509.PE15

CP000509.PE15        Location/Qualifiers
FT   CDS             17570..18589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0015"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   fal:FRAAL0743 hypothetical protein; putative signal
FT                   peptide; putative acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79565"
FT                   /db_xref="GOA:A1SCN0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN0"
FT                   /protein_id="ABL79565.1"
FT                   /translation="MIRLLRRLVIAPAVVALTGLLWFTLPLWVIGAAALSPVVPGRLRP
FT                   LRIMWVAIVYLTCEAILLVVLFGLWLASGFGWRLRSPYFEGIHYDLVQGTMWVFFREAR
FT                   RVLRLRIETEGPAPDAHPGRPVLVCCRHAGPGDSFVLIHTLMAWYAREPRVVLKDTLAW
FT                   DPAIDVILNRIPARFITPNPADGDRLEDQIATLATGLDENDAFVIFPEGGNFTPQRRQR
FT                   AIDRLRRLGMERMAARAERMTHVLAPRPGGFLAALDAAPDADVVLVAHTGLDHLLTVGD
FT                   VWRELPMDKRIVMRWWQVPRGEIPADRDERIDWLYGWWERIDVWIQQNRPEDLSPGRR"
     MIRLLRRLVI APAVVALTGL LWFTLPLWVI GAAALSPVVP GRLRPLRIMW VAIVYLTCEA        60
     ILLVVLFGLW LASGFGWRLR SPYFEGIHYD LVQGTMWVFF REARRVLRLR IETEGPAPDA       120
     HPGRPVLVCC RHAGPGDSFV LIHTLMAWYA REPRVVLKDT LAWDPAIDVI LNRIPARFIT       180
     PNPADGDRLE DQIATLATGL DENDAFVIFP EGGNFTPQRR QRAIDRLRRL GMERMAARAE       240
     RMTHVLAPRP GGFLAALDAA PDADVVLVAH TGLDHLLTVG DVWRELPMDK RIVMRWWQVP       300
     RGEIPADRDE RIDWLYGWWE RIDVWIQQNR PEDLSPGRR                              339
//

If you have problems or comments...

PBIL Back to PBIL home page