(data stored in ACNUC1104 zone)

EMBL: CP000509.PE154

CP000509.PE154       Location/Qualifiers
FT   CDS             173827..175029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79704"
FT                   /db_xref="GOA:A1SD19"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD19"
FT                   /protein_id="ABL79704.1"
FT                   /translation="MDPIRNPYAPGAGQRPPELAGRDRELEQFEVTLERVAANRPERSM
FT                   VLSGLRGVGKTVLLNALRGQAVRRAWGTGKIEARPDQSVRLPVAQAVHAAVREVAHRHR
FT                   DPDRVDAVAGVLKSFALRTGVDERRAAARAGARWTPPVDVPATRGRADSGDLELDLVEL
FT                   FTDVATLAGDLGVGVALFVDEMQDVAPPELAAVCGACHEISQQGAPLIVVGAGLPHLPV
FT                   ALAASKSYAERLFRYVSVDRLPRPMADRAWRVPAGSEGVTFEEAALDELYRLTDGYPYF
FT                   VQAYGKVTWDAAVGSPIRVADVQAAAPEAEAELAVGFFGARYDRATPAERDYMTAMADL
FT                   GAEHGDAAVATADIARHLARKPQSLSPARDGLIKKGLVYSAERGSVAFTVPHFGKFLRS
FT                   R"
     MDPIRNPYAP GAGQRPPELA GRDRELEQFE VTLERVAANR PERSMVLSGL RGVGKTVLLN        60
     ALRGQAVRRA WGTGKIEARP DQSVRLPVAQ AVHAAVREVA HRHRDPDRVD AVAGVLKSFA       120
     LRTGVDERRA AARAGARWTP PVDVPATRGR ADSGDLELDL VELFTDVATL AGDLGVGVAL       180
     FVDEMQDVAP PELAAVCGAC HEISQQGAPL IVVGAGLPHL PVALAASKSY AERLFRYVSV       240
     DRLPRPMADR AWRVPAGSEG VTFEEAALDE LYRLTDGYPY FVQAYGKVTW DAAVGSPIRV       300
     ADVQAAAPEA EAELAVGFFG ARYDRATPAE RDYMTAMADL GAEHGDAAVA TADIARHLAR       360
     KPQSLSPARD GLIKKGLVYS AERGSVAFTV PHFGKFLRSR                             400
//

If you have problems or comments...

PBIL Back to PBIL home page