(data stored in SCRATCH zone)

EMBL: CP000509.PE157

CP000509.PE157       Location/Qualifiers
FT   CDS             176321..177259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0162"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: sma:SAV4226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79707"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD22"
FT                   /protein_id="ABL79707.1"
FT                   /translation="MAKKSRTKARDHQPASGEVGPRQPCPCGSGKRYKACHGAAGGAPA
FT                   PFVNRPFEGLPSECDIVAMRELVPAATAPLTLVDHADRTVQLCTLLPMAAPAMVRDSGE
FT                   IWLGLQVQHNFGDPARDLGAVLAKALTADAGIVGLTDPPGEGPRLQDLVTGDRLAVTVH
FT                   EGFEFWIGDVEESERAGMAAALEQANTAAMPTARLTTVEAAYWTDVGTKEHLRWVLPEP
FT                   EDRLLDALARLHAAGNDGLVAGSRFVGMFRAHGLLAPVWDLPLGTGPEPLEEPAERFAA
FT                   DLAQALADTSDLTADERAARSGLANRQVTIR"
     MAKKSRTKAR DHQPASGEVG PRQPCPCGSG KRYKACHGAA GGAPAPFVNR PFEGLPSECD        60
     IVAMRELVPA ATAPLTLVDH ADRTVQLCTL LPMAAPAMVR DSGEIWLGLQ VQHNFGDPAR       120
     DLGAVLAKAL TADAGIVGLT DPPGEGPRLQ DLVTGDRLAV TVHEGFEFWI GDVEESERAG       180
     MAAALEQANT AAMPTARLTT VEAAYWTDVG TKEHLRWVLP EPEDRLLDAL ARLHAAGNDG       240
     LVAGSRFVGM FRAHGLLAPV WDLPLGTGPE PLEEPAERFA ADLAQALADT SDLTADERAA       300
     RSGLANRQVT IR                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page