(data stored in SCRATCH zone)

EMBL: CP000509.PE158

CP000509.PE158       Location/Qualifiers
FT   CDS             complement(177386..178240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV5728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79708"
FT                   /db_xref="GOA:A1SD23"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD23"
FT                   /protein_id="ABL79708.1"
FT                   /translation="MENVLLATFELLPQGEDGGDLLPRELARLGIEARWAVWTDPEVDW
FT                   SRADAVVVRSTWDYHRRLPEFLAWADRVAATTRLVNAPDVLRWNADKRYLLDLADAVPV
FT                   VPTRDVPPDGLVAGLADGLAEHGTVVVKPRVGASGVGVVVAERSDDLRLAGLTAGPWLV
FT                   QPLVTSVRTEGEASVFVFAGRAVSQLRKVATSGDVRVHEEYGGTTTPVPLDAEAAALAE
FT                   RAVAVAGEHCGPAPAYGRVDLLHHHGRLVVSEVELIEPGLYLDLLPGNAEALAAALAAV
FT                   LVT"
     MENVLLATFE LLPQGEDGGD LLPRELARLG IEARWAVWTD PEVDWSRADA VVVRSTWDYH        60
     RRLPEFLAWA DRVAATTRLV NAPDVLRWNA DKRYLLDLAD AVPVVPTRDV PPDGLVAGLA       120
     DGLAEHGTVV VKPRVGASGV GVVVAERSDD LRLAGLTAGP WLVQPLVTSV RTEGEASVFV       180
     FAGRAVSQLR KVATSGDVRV HEEYGGTTTP VPLDAEAAAL AERAVAVAGE HCGPAPAYGR       240
     VDLLHHHGRL VVSEVELIEP GLYLDLLPGN AEALAAALAA VLVT                        284
//

If you have problems or comments...

PBIL Back to PBIL home page