(data stored in ACNUC1104 zone)

EMBL: CP000509.PE16

CP000509.PE16        Location/Qualifiers
FT   CDS             complement(18611..19255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aor:AO090120000081 predicted protein Pfam:
FT                   IncA TolA PROSITE: ALA_RICH ARG_RICH GLU_RICH GLY_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79566"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN1"
FT                   /protein_id="ABL79566.1"
FT                   /translation="MGLRKKKSLIDQASETVTQYVDQVKPQLESAVATAREKAGPVIAD
FT                   ARTKAAPVLADARAKAAPVIAEARAKAAPAIASGAALAAEKVAAGASLAAERAAEAADA
FT                   AATKVTEVATPRKKKRGKGKKLLLLTGLAALAAFVAKKLRGSDQSANWQSSYTPTPAPA
FT                   PASPAAAPAQPTDDEGGSSPDEAIADQAEAPHPVTTPDDPAEVVEVDENKG"
     MGLRKKKSLI DQASETVTQY VDQVKPQLES AVATAREKAG PVIADARTKA APVLADARAK        60
     AAPVIAEARA KAAPAIASGA ALAAEKVAAG ASLAAERAAE AADAAATKVT EVATPRKKKR       120
     GKGKKLLLLT GLAALAAFVA KKLRGSDQSA NWQSSYTPTP APAPASPAAA PAQPTDDEGG       180
     SSPDEAIADQ AEAPHPVTTP DDPAEVVEVD ENKG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page