(data stored in ACNUC1104 zone)

EMBL: CP000509.PE160

CP000509.PE160       Location/Qualifiers
FT   CDS             complement(179430..179804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0165"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: mmc:Mmcs_2490
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79710"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD25"
FT                   /protein_id="ABL79710.1"
FT                   /translation="MAESFYDAFAPEEIARIAAAGTRVHVPEGWSPIWEKTPADKAYII
FT                   LDGTVSVRHRGEEIAQLGAGEIVGEAAIVNHSLRTASIVALTPLELIHFTDEAVRRLCA
FT                   EMPAFKTALEAVAVERFGRN"
     MAESFYDAFA PEEIARIAAA GTRVHVPEGW SPIWEKTPAD KAYIILDGTV SVRHRGEEIA        60
     QLGAGEIVGE AAIVNHSLRT ASIVALTPLE LIHFTDEAVR RLCAEMPAFK TALEAVAVER       120
     FGRN                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page