(data stored in ACNUC1104 zone)

EMBL: CP000509.PE170

CP000509.PE170       Location/Qualifiers
FT   CDS             188777..189625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0175"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   sucrose-6F-phosphate phosphohydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase, type 3; KEGG:
FT                   pac:PPA2205 hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79720"
FT                   /db_xref="GOA:A1SD35"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD35"
FT                   /protein_id="ABL79720.1"
FT                   /translation="MSGPVSGWRPRLVALDIDGTILKWVEGSGTTREEISPTVKESVHR
FT                   VLAAGAHVVLASGRSPHGMTNVADLLELHGPGRDRLWIVASNGAVVFRYPPLDVVHEET
FT                   FDARPAVEAILDRHPTALVAVEERGVGYRVNSHFPDGELSGDMIVTEIDELLAVEVSRV
FT                   IIRDPESTADEFVALAEELGLQGTNYVVGWTAWLDLAPVGVSKASGLEYVAKQLGISSD
FT                   DTLALGDGRNDVEMFEWAHRGVAMGQAIEEVLAKADAVTGSVYEDGVATELDRWFGDGR
FT                   A"
     MSGPVSGWRP RLVALDIDGT ILKWVEGSGT TREEISPTVK ESVHRVLAAG AHVVLASGRS        60
     PHGMTNVADL LELHGPGRDR LWIVASNGAV VFRYPPLDVV HEETFDARPA VEAILDRHPT       120
     ALVAVEERGV GYRVNSHFPD GELSGDMIVT EIDELLAVEV SRVIIRDPES TADEFVALAE       180
     ELGLQGTNYV VGWTAWLDLA PVGVSKASGL EYVAKQLGIS SDDTLALGDG RNDVEMFEWA       240
     HRGVAMGQAI EEVLAKADAV TGSVYEDGVA TELDRWFGDG RA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page