(data stored in SCRATCH zone)

EMBL: CP000509.PE171

CP000509.PE171       Location/Qualifiers
FT   CDS             189625..190122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0176"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sco:SCO4311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79721"
FT                   /db_xref="GOA:A1SD36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD36"
FT                   /protein_id="ABL79721.1"
FT                   /translation="MLPDGPPEVVTSERLRLPLWTPQDAADIRAGRHREGWHRDYPRPD
FT                   DRDAATIYRSGDPWAPRHVVRGVTALGSIGFFGPPQAAADGVPEVEVGYGLVAEARGWG
FT                   FATEALRALLAETDRAGVRVRASVDPANTASVRVLAKCGFTELRGSNEDGELVMARPLP
FT                   AS"
     MLPDGPPEVV TSERLRLPLW TPQDAADIRA GRHREGWHRD YPRPDDRDAA TIYRSGDPWA        60
     PRHVVRGVTA LGSIGFFGPP QAAADGVPEV EVGYGLVAEA RGWGFATEAL RALLAETDRA       120
     GVRVRASVDP ANTASVRVLA KCGFTELRGS NEDGELVMAR PLPAS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page