(data stored in ACNUC1104 zone)

EMBL: CP000509.PE173

CP000509.PE173       Location/Qualifiers
FT   CDS             190923..191534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79723"
FT                   /db_xref="GOA:A1SD38"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD38"
FT                   /protein_id="ABL79723.1"
FT                   /translation="MDAVPVPVPGSVTRLPRLLLAALLLAGGGVVATGAMAAPALACPA
FT                   SRTGLDQLTMQADDVFTGAVEDRARQGRTIVYTVTVDRVYKGDLDGTEATVTTPARARA
FT                   CGLPDLRTGTDYVFFTQGADLETTSTAGTAPAAATLLRRVERLLGEGHPATPPTPPEAT
FT                   FTLVGEQPTSFERVAAPGAALVIAGLLGLLLVAGLSRRRA"
     MDAVPVPVPG SVTRLPRLLL AALLLAGGGV VATGAMAAPA LACPASRTGL DQLTMQADDV        60
     FTGAVEDRAR QGRTIVYTVT VDRVYKGDLD GTEATVTTPA RARACGLPDL RTGTDYVFFT       120
     QGADLETTST AGTAPAAATL LRRVERLLGE GHPATPPTPP EATFTLVGEQ PTSFERVAAP       180
     GAALVIAGLL GLLLVAGLSR RRA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page