(data stored in ACNUC1104 zone)

EMBL: CP000509.PE175

CP000509.PE175       Location/Qualifiers
FT   CDS             complement(192241..193218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0180"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sma:SAV4368 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79725"
FT                   /db_xref="GOA:A1SD40"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD40"
FT                   /protein_id="ABL79725.1"
FT                   /translation="MRAVIATGAGGPDVLSVAELPDPEPGPGEVLLAVAAAGLNRADLL
FT                   QRQGFYPPPPGASDVIGMECSGTVAALGEGVEGWAVGDPACALLAGGGYAELVAVPSGQ
FT                   LMPVPDGVDLVTAAALPEVACTVWSNVFMLGGLKPGEAFLVHGGAGGIGTFAIQLAHQL
FT                   GAQVLTTAGTAEKRAACAALGADVTIDYRDQDFVEVARAATEGRGVDLVLDNMGAKYLD
FT                   RNLDALATEGRLVIIGMQGGTRAELDINKLLRKRGAIIATTLRARPTEEKSAICASVVE
FT                   HVWPLVAEGLVRPVVHGTMPLAEAGAAHALMESGEHSGKILLTV"
     MRAVIATGAG GPDVLSVAEL PDPEPGPGEV LLAVAAAGLN RADLLQRQGF YPPPPGASDV        60
     IGMECSGTVA ALGEGVEGWA VGDPACALLA GGGYAELVAV PSGQLMPVPD GVDLVTAAAL       120
     PEVACTVWSN VFMLGGLKPG EAFLVHGGAG GIGTFAIQLA HQLGAQVLTT AGTAEKRAAC       180
     AALGADVTID YRDQDFVEVA RAATEGRGVD LVLDNMGAKY LDRNLDALAT EGRLVIIGMQ       240
     GGTRAELDIN KLLRKRGAII ATTLRARPTE EKSAICASVV EHVWPLVAEG LVRPVVHGTM       300
     PLAEAGAAHA LMESGEHSGK ILLTV                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page