(data stored in ACNUC1104 zone)

EMBL: CP000509.PE176

CP000509.PE176       Location/Qualifiers
FT   CDS             complement(193256..193606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3828 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79726"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD41"
FT                   /protein_id="ABL79726.1"
FT                   /translation="MNLHDWIDELSDVLDVDTELDEALVLDLARAAAHNVARPAAPITT
FT                   FLLGFAAGSQDADPDAVEALAAKAQALADGWDRPANAPDPDDINDPVPDDSVVDHTGDV
FT                   FEDENAGADEEE"
     MNLHDWIDEL SDVLDVDTEL DEALVLDLAR AAAHNVARPA APITTFLLGF AAGSQDADPD        60
     AVEALAAKAQ ALADGWDRPA NAPDPDDIND PVPDDSVVDH TGDVFEDENA GADEEE           116
//

If you have problems or comments...

PBIL Back to PBIL home page