(data stored in ACNUC1104 zone)

EMBL: CP000509.PE177

CP000509.PE177       Location/Qualifiers
FT   CDS             complement(193659..194276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0182"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /note="KEGG: sma:SAV4365 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79727"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD42"
FT                   /protein_id="ABL79727.1"
FT                   /translation="MDLPPGTTGFCAVVLAGGRAARLDGADKASVEYLGRTLLEHAIEA
FT                   LLDASEVVVVGDPVPTTRPVTFTRESPRYGGPVAGLLTGRDALVRTPRTLGVLAVDMPR
FT                   VTSWTFRRLHEAAIGHDGAFLTDQDGHRQPAGVLDPAGLDRVRPDHEGQHGMALRRLLG
FT                   ELDLVDVPPEGDEGRDVDTWTDLRDLGRDPDRDPGRDLGGDL"
     MDLPPGTTGF CAVVLAGGRA ARLDGADKAS VEYLGRTLLE HAIEALLDAS EVVVVGDPVP        60
     TTRPVTFTRE SPRYGGPVAG LLTGRDALVR TPRTLGVLAV DMPRVTSWTF RRLHEAAIGH       120
     DGAFLTDQDG HRQPAGVLDP AGLDRVRPDH EGQHGMALRR LLGELDLVDV PPEGDEGRDV       180
     DTWTDLRDLG RDPDRDPGRD LGGDL                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page