(data stored in ACNUC1104 zone)

EMBL: CP000509.PE18

CP000509.PE18        Location/Qualifiers
FT   CDS             19941..20861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0018"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: mmc:Mmcs_5148
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79568"
FT                   /db_xref="GOA:A1SCN3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN3"
FT                   /protein_id="ABL79568.1"
FT                   /translation="MSEHATPPAGVPTCYRHPGREAHIRCQRCDRPICPDCMRDAAVGF
FT                   QCPECVAEGRKSTRAGRTAFGGLRPGNAGTTSFVLIGINAFVWLMILASGGSSSRVLAW
FT                   LELRPNGLCLNAAGGFDTTRAVCSGRGEWLPGVYDGAYWQLLTSTFTHVQPLHIAFNMF
FT                   ALYVLGPQLELAIGRIRFLALYLLSGLTGSALVYWASPEFQATVGASGAIFGLMGALLV
FT                   VAYKMRANTQQILMWIGINFVFTVVVSNISWQGHLGGFLGGLVIAAILVYAPRGPKRPW
FT                   FQVSGLVLVAALTAVAVVLRTAALG"
     MSEHATPPAG VPTCYRHPGR EAHIRCQRCD RPICPDCMRD AAVGFQCPEC VAEGRKSTRA        60
     GRTAFGGLRP GNAGTTSFVL IGINAFVWLM ILASGGSSSR VLAWLELRPN GLCLNAAGGF       120
     DTTRAVCSGR GEWLPGVYDG AYWQLLTSTF THVQPLHIAF NMFALYVLGP QLELAIGRIR       180
     FLALYLLSGL TGSALVYWAS PEFQATVGAS GAIFGLMGAL LVVAYKMRAN TQQILMWIGI       240
     NFVFTVVVSN ISWQGHLGGF LGGLVIAAIL VYAPRGPKRP WFQVSGLVLV AALTAVAVVL       300
     RTAALG                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page