(data stored in ACNUC1104 zone)

EMBL: CP000509.PE181

CP000509.PE181       Location/Qualifiers
FT   CDS             complement(196675..197058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79731"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD46"
FT                   /protein_id="ABL79731.1"
FT                   /translation="MTITTTGMSVALQGLRQALYSLSEPGVSLGSWRWSVRQQMAGVRD
FT                   ALLAEAEYADEGWLAARTGSVLRERTALLGRLSALGTPVLESDDVDAVCTELDRLLVDL
FT                   GRHAQRLHDLAYDEVELELGGSE"
     MTITTTGMSV ALQGLRQALY SLSEPGVSLG SWRWSVRQQM AGVRDALLAE AEYADEGWLA        60
     ARTGSVLRER TALLGRLSAL GTPVLESDDV DAVCTELDRL LVDLGRHAQR LHDLAYDEVE       120
     LELGGSE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page