(data stored in ACNUC1104 zone)

EMBL: CP000509.PE183

CP000509.PE183       Location/Qualifiers
FT   CDS             197905..198672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0188"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; Helix-turn-helix,
FT                   type 11 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   sma:SAV86 erythropoiesis-stimulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79733"
FT                   /db_xref="GOA:A1SD48"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD48"
FT                   /protein_id="ABL79733.1"
FT                   /translation="MVEKVGVGLGPRNRIPEMRRQEALDAAAILQMRRSELAARLARGE
FT                   DCQARVVARTLAGINEWMREDCLGWRDLLSVRPSGTLPQLRVSVPHNRSLVATGLQMVS
FT                   LLDHDGCVPAARIFLANEEPGYYRFGVGPVQMKIVDRRYVLLQGPFVDDESTLMAVTAP
FT                   DCLAAAWQYWHASMASSFPAEEEAAGGLAALTPRQRQVVVLLADDTRDAAIAETLDVSV
FT                   RTVRSDIAELMERLGVRSRFAAGVRVKELLREQ"
     MVEKVGVGLG PRNRIPEMRR QEALDAAAIL QMRRSELAAR LARGEDCQAR VVARTLAGIN        60
     EWMREDCLGW RDLLSVRPSG TLPQLRVSVP HNRSLVATGL QMVSLLDHDG CVPAARIFLA       120
     NEEPGYYRFG VGPVQMKIVD RRYVLLQGPF VDDESTLMAV TAPDCLAAAW QYWHASMASS       180
     FPAEEEAAGG LAALTPRQRQ VVVLLADDTR DAAIAETLDV SVRTVRSDIA ELMERLGVRS       240
     RFAAGVRVKE LLREQ                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page