(data stored in ACNUC1104 zone)

EMBL: CP000509.PE191

CP000509.PE191       Location/Qualifiers
FT   CDS             complement(208506..209549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0196"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: dge:Dgeo_2243
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79741"
FT                   /db_xref="GOA:A1SD56"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD56"
FT                   /protein_id="ABL79741.1"
FT                   /translation="MAKVTLQSIADRVGVSRMTVSNAFSRPDQLSGELRERILAAADEL
FT                   GYVGPDPAARALARGRTGSVGLLLTDELGEAFQDAVATQFLTSVADALTHEGLAVTLLT
FT                   SGGAAGAPSDYVPARDVAMDGAIVYICDPASPDIAWLERRGLPLVSVDREPAPDAPSVN
FT                   VDDRAGARAAAEHLIELGHTRVAIITLRSTFDVAGVPTANRPASERMTGWREALEAAGI
FT                   EPVVAAAAFRPRPSVEEIARDLLDRPDRPTAVLCFSDAFAVTTIQVAESLGLRVPEDLS
FT                   VVGYDDSPLATAIRPQLTTVHQEVARKGQEAVRSLMAIMGPDRPDPVERILLPTALVVR
FT                   DSTAPPP"
     MAKVTLQSIA DRVGVSRMTV SNAFSRPDQL SGELRERILA AADELGYVGP DPAARALARG        60
     RTGSVGLLLT DELGEAFQDA VATQFLTSVA DALTHEGLAV TLLTSGGAAG APSDYVPARD       120
     VAMDGAIVYI CDPASPDIAW LERRGLPLVS VDREPAPDAP SVNVDDRAGA RAAAEHLIEL       180
     GHTRVAIITL RSTFDVAGVP TANRPASERM TGWREALEAA GIEPVVAAAA FRPRPSVEEI       240
     ARDLLDRPDR PTAVLCFSDA FAVTTIQVAE SLGLRVPEDL SVVGYDDSPL ATAIRPQLTT       300
     VHQEVARKGQ EAVRSLMAIM GPDRPDPVER ILLPTALVVR DSTAPPP                     347
//

If you have problems or comments...

PBIL Back to PBIL home page