(data stored in ACNUC1104 zone)

EMBL: CP000509.PE2

CP000509.PE2         Location/Qualifiers
FT   CDS             2029..3255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sma:SAV4317 putative DNA polymerase III beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79552"
FT                   /db_xref="GOA:A1SCL7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCL7"
FT                   /protein_id="ABL79552.1"
FT                   /translation="MQSPERALLPPPFNPRSTLAPPSRPEGTIVKFRVERDVLADAVAW
FT                   AARSLPVRPSVPVLAGLLVEASDDGLVLSTFDYETSARATLTAEVSDEGQALVSGRLLA
FT                   DICRSLPAKPVEMVLDGARVSLTCGSARFSLQTMPVDDYPSLPSMPAATGTVQSEAFAH
FT                   AVAQAVTAAGRDDMLPVLTGVRIEIDGSTISLLATDRFRLSHRELEWSPRTPDESAAAL
FT                   VPARVLGDTAKSLTGGGEVTIALATTGSGEGIIGFEGHGPGGLRRTTTRLLDGEFPKVR
FT                   SLFPNEHQTTALVDKAALVESVKRVALVAERNTAVQLAFSDGVLTLDAGSGDEAQASES
FT                   IEATIDGEDITTGFNPQFLLDGLTAIDQPVVELAFTQASKPVVISGAVDGDDTDSSFRY
FT                   LLMPRRLLS"
     MQSPERALLP PPFNPRSTLA PPSRPEGTIV KFRVERDVLA DAVAWAARSL PVRPSVPVLA        60
     GLLVEASDDG LVLSTFDYET SARATLTAEV SDEGQALVSG RLLADICRSL PAKPVEMVLD       120
     GARVSLTCGS ARFSLQTMPV DDYPSLPSMP AATGTVQSEA FAHAVAQAVT AAGRDDMLPV       180
     LTGVRIEIDG STISLLATDR FRLSHRELEW SPRTPDESAA ALVPARVLGD TAKSLTGGGE       240
     VTIALATTGS GEGIIGFEGH GPGGLRRTTT RLLDGEFPKV RSLFPNEHQT TALVDKAALV       300
     ESVKRVALVA ERNTAVQLAF SDGVLTLDAG SGDEAQASES IEATIDGEDI TTGFNPQFLL       360
     DGLTAIDQPV VELAFTQASK PVVISGAVDG DDTDSSFRYL LMPRRLLS                    408
//

If you have problems or comments...

PBIL Back to PBIL home page