(data stored in ACNUC1104 zone)

EMBL: CP000509.PE200

CP000509.PE200       Location/Qualifiers
FT   CDS             complement(220244..221431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0205"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="KEGG: rme:Rmet_5998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79750"
FT                   /db_xref="GOA:A1SD65"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD65"
FT                   /protein_id="ABL79750.1"
FT                   /translation="MCATPDRPISRRGLLHTGGLATAAIAASSALPPTRAEAATVRRST
FT                   RATRDYRTKVVLLGTSGGPIWWRGSTRRGTSSAVVVGDAQYIVDLGAGALGSVRDAGLL
FT                   GSADGKNDLHALRGVFLTHLHSDHVSDYPTLVIEGWIGGGLGDAERALQVYGPGRRDAL
FT                   PHTFPAGRPEPSPVIPDNPGPGTVEMTESLFAAFATDINDRVFDSASPDIRSRIQPHDI
FT                   ALPADVAAPEAGAVPRMSPFSVYEDDRVRVTATLVDHGQMLPSFGYRFDTEDGSVVISG
FT                   DTTVSENLVELAADCDVLVHEVIDQAWVEESISALPAPDEVKAAYKNHMLGAHTTIPQV
FT                   ARVATEAGARTLVLHHFVPGHLPERRWRRVSRNFAGELVVGQDLQRIGVGRRRRG"
     MCATPDRPIS RRGLLHTGGL ATAAIAASSA LPPTRAEAAT VRRSTRATRD YRTKVVLLGT        60
     SGGPIWWRGS TRRGTSSAVV VGDAQYIVDL GAGALGSVRD AGLLGSADGK NDLHALRGVF       120
     LTHLHSDHVS DYPTLVIEGW IGGGLGDAER ALQVYGPGRR DALPHTFPAG RPEPSPVIPD       180
     NPGPGTVEMT ESLFAAFATD INDRVFDSAS PDIRSRIQPH DIALPADVAA PEAGAVPRMS       240
     PFSVYEDDRV RVTATLVDHG QMLPSFGYRF DTEDGSVVIS GDTTVSENLV ELAADCDVLV       300
     HEVIDQAWVE ESISALPAPD EVKAAYKNHM LGAHTTIPQV ARVATEAGAR TLVLHHFVPG       360
     HLPERRWRRV SRNFAGELVV GQDLQRIGVG RRRRG                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page