(data stored in ACNUC1104 zone)

EMBL: CP000509.PE202

CP000509.PE202       Location/Qualifiers
FT   CDS             222790..223707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0207"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_1630
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79752"
FT                   /db_xref="GOA:A1SD67"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD67"
FT                   /protein_id="ABL79752.1"
FT                   /translation="MITQLAYLGIASPNYQQWRDYGTRLLGTQLAADGPDGAVRLRVDD
FT                   KGYRIAVHPAEQDEFRYAGWACHNETELRSYVAELRGKGLEVHEGTPEELKERQVAELY
FT                   WIQDPWGNRHELVWGQFSMPNSFWPARKMNGFVTGDLGLGHIVMIVPDLQAADAFYAET
FT                   LGFRLSDRVVSDIFNLRFYHCNGRHHSLAVAEIPGMTGINHLMLEVENMDDLGSAIDLF
FT                   TADQEREILLSLGRHTNDLMTSIYVQTPSSMQIEYGFGGIAVDDLTWVAGTHDVPSIWG
FT                   HHRSQAYLDGPPGIFQMLDAEAPA"
     MITQLAYLGI ASPNYQQWRD YGTRLLGTQL AADGPDGAVR LRVDDKGYRI AVHPAEQDEF        60
     RYAGWACHNE TELRSYVAEL RGKGLEVHEG TPEELKERQV AELYWIQDPW GNRHELVWGQ       120
     FSMPNSFWPA RKMNGFVTGD LGLGHIVMIV PDLQAADAFY AETLGFRLSD RVVSDIFNLR       180
     FYHCNGRHHS LAVAEIPGMT GINHLMLEVE NMDDLGSAID LFTADQEREI LLSLGRHTND       240
     LMTSIYVQTP SSMQIEYGFG GIAVDDLTWV AGTHDVPSIW GHHRSQAYLD GPPGIFQMLD       300
     AEAPA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page