(data stored in SCRATCH zone)

EMBL: CP000509.PE205

CP000509.PE205       Location/Qualifiers
FT   CDS             225787..226626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0210"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ttj:TTHB237
FT                   2-hydroxymuconic semialdehyde hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79755"
FT                   /db_xref="GOA:A1SD70"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD70"
FT                   /protein_id="ABL79755.1"
FT                   /translation="MIRTRDVEVGDLSFRLYETGETGAEAVLFLHGSGPGATGLSNWER
FT                   IIEDLGDRFHCLAPDMIGFGDSAHPVDPPRGMGPFNELRAQALLGLLDVLGLEKVHLVG
FT                   NSMGGQLALLMVLAQPDRVGKILLMGSGGAPDLPVSPGLAHLRTFYDAPSAESLERLLE
FT                   QFVFDLEPMRPVIDRVVKERMAYVERADVRRSHAASFDPDGPRRFFTPEELAGIEHDVL
FT                   VVHGRDDRIIPTQASRWFADHLPNANLYVIGRCGHWTQIEHPTTFETLLTGLVDGVI"
     MIRTRDVEVG DLSFRLYETG ETGAEAVLFL HGSGPGATGL SNWERIIEDL GDRFHCLAPD        60
     MIGFGDSAHP VDPPRGMGPF NELRAQALLG LLDVLGLEKV HLVGNSMGGQ LALLMVLAQP       120
     DRVGKILLMG SGGAPDLPVS PGLAHLRTFY DAPSAESLER LLEQFVFDLE PMRPVIDRVV       180
     KERMAYVERA DVRRSHAASF DPDGPRRFFT PEELAGIEHD VLVVHGRDDR IIPTQASRWF       240
     ADHLPNANLY VIGRCGHWTQ IEHPTTFETL LTGLVDGVI                              279
//

If you have problems or comments...

PBIL Back to PBIL home page