(data stored in SCRATCH zone)

EMBL: CP000509.PE207

CP000509.PE207       Location/Qualifiers
FT   CDS             complement(227624..227929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79757"
FT                   /db_xref="GOA:A1SD72"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD72"
FT                   /protein_id="ABL79757.1"
FT                   /translation="MDTRSADLDTVSTRAGTATLGLGLLFLAATIFIFVLSLSDLVDPP
FT                   TWVRVLGLVWLPLGFFGAPLTYAVARAGPGRNRGRLGLALMLVPLAAFVALLFVAG"
     MDTRSADLDT VSTRAGTATL GLGLLFLAAT IFIFVLSLSD LVDPPTWVRV LGLVWLPLGF        60
     FGAPLTYAVA RAGPGRNRGR LGLALMLVPL AAFVALLFVA G                           101
//

If you have problems or comments...

PBIL Back to PBIL home page