(data stored in ACNUC1104 zone)

EMBL: CP000509.PE21

CP000509.PE21        Location/Qualifiers
FT   CDS             22883..23704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0021"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   pac:PPA0183 membrane spanning protein DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79571"
FT                   /db_xref="GOA:A1SCN6"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN6"
FT                   /protein_id="ABL79571.1"
FT                   /translation="MRGRTHARPPEPSGPGALRTRLARRSVDRPRSLWRIGTPVVVLLC
FT                   GALFVVSAANSDGTDLRPGRYTDLASLVQDEADQYAELQQRRTELNNQVAALSAAVSDR
FT                   DVNRYQRRVEELKDPAGLVPRSGPGISVTLSDAPEDVINSTTGDINELLVHQQDIQAVV
FT                   NALWKGGATAVTIAGQRIVSTTGIKCEGNAVQLQGVPYPQPYVIQAVGDQGALLTAIEG
FT                   DGYVSAYREDAADPDISVGWELDLEEQVTAPAYDGLLDLNYAEPLVPISGS"
     MRGRTHARPP EPSGPGALRT RLARRSVDRP RSLWRIGTPV VVLLCGALFV VSAANSDGTD        60
     LRPGRYTDLA SLVQDEADQY AELQQRRTEL NNQVAALSAA VSDRDVNRYQ RRVEELKDPA       120
     GLVPRSGPGI SVTLSDAPED VINSTTGDIN ELLVHQQDIQ AVVNALWKGG ATAVTIAGQR       180
     IVSTTGIKCE GNAVQLQGVP YPQPYVIQAV GDQGALLTAI EGDGYVSAYR EDAADPDISV       240
     GWELDLEEQV TAPAYDGLLD LNYAEPLVPI SGS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page